PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G123400.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 751aa    MW: 83658.1 Da    PI: 7.6738
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G123400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.28e-13177218345
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           rW+ eE e l + v+++G+++W tIa  ++ gR + +c srw 
  Sobic.004G123400.2.p 177 RWSSEENEALTQMVNKHGTKDWQTIACAIP-GRNAHSCFSRWK 218
                           9*****************************.***********7 PP

2Myb_DNA-binding34.25.7e-11227269145
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           + +W+++E+++l++a + +G++ W +  ++++ gRt   +k++w+
  Sobic.004G123400.2.p 227 KEPWSQQEELRLIRAQQVYGNK-WCKMVKHFP-GRTNGALKEHWR 269
                           679*******************.*********.***********7 PP

3Myb_DNA-binding42.51.5e-13434476145
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           +g+W +eE e+l + v+++G++ W t+a+ ++ gR +kqc+ rw 
  Sobic.004G123400.2.p 434 KGKWLAEENEILTKMVAKHGKN-WQTVASAIP-GREAKQCRIRWT 476
                           79******************99.*********.***********5 PP

4Myb_DNA-binding33.31.1e-10487527345
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            W+++E+++l++a++ +G+  W +  ++++ gRt   +k++w+
  Sobic.004G123400.2.p 487 GWSEQEELKLIRAHQIYGSQ-WLKMVKHFP-GRTNHALKEHWR 527
                           6*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.821170219IPR017930Myb domain
SMARTSM007174.9E-10174223IPR001005SANT/Myb domain
SuperFamilySSF466891.58E-24176268IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-18177230IPR009057Homeodomain-like
CDDcd001679.49E-10177221No hitNo description
PfamPF139215.2E-14178238No hitNo description
PROSITE profilePS5129419.174222276IPR017930Myb domain
SMARTSM007171.2E-11226274IPR001005SANT/Myb domain
CDDcd001672.00E-8229269No hitNo description
Gene3DG3DSA:1.10.10.604.6E-16231276IPR009057Homeodomain-like
PROSITE profilePS5129419.781429483IPR017930Myb domain
SuperFamilySSF466891.05E-21431526IPR009057Homeodomain-like
SMARTSM007178.7E-13433481IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-20435486IPR009057Homeodomain-like
CDDcd001671.75E-8436479No hitNo description
PfamPF139214.2E-15437496No hitNo description
PROSITE profilePS5129412.862484534IPR017930Myb domain
SMARTSM007177.9E-10484532IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-15487534IPR009057Homeodomain-like
CDDcd001673.20E-8488527No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MDEGSTKGAS FPKRAEVPLA RATGQLAREP RFLNSSPSEP ESCHTASGEA CGGIGASYLS  60
AAMEQSSDGV PINQRRANSP TEHPSKSDEV AQDMLQSDIP HETVRHCQNA ESEETGSWLL  120
ALQAHLKKGS QQDMSDIPHE PVRHCQDTES EGIEGPPRKK IVHSFKESSS SKSQIRRWSS  180
EENEALTQMV NKHGTKDWQT IACAIPGRNA HSCFSRWKYI LDPAINKEPW SQQEELRLIR  240
AQQVYGNKWC KMVKHFPGRT NGALKEHWRG SMKRKLDSYL ASGLLEHIPD LQDDVSFPQS  300
NQSDIPKDCK AASDRNRFSS RLSTNPKLKQ ELTELVENAN TSARKSSDLF YAKAPDTHSA  360
KISEMTMAKS QQCAGTRKKL AFLSTPVELK NVVPHETTKH CHDMESEKTE VPLCKKNAHC  420
IKDGSSLKIP ERAKGKWLAE ENEILTKMVA KHGKNWQTVA SAIPGREAKQ CRIRWTRSLD  480
PAINKEGWSE QEELKLIRAH QIYGSQWLKM VKHFPGRTNH ALKEHWRGRM KGKLNFYLAS  540
GLLEQVPDLE EDISVPESSQ SDILKDSQGS SDRSRPPSVL RTRPKSKQEL PELDENAGTS  600
EEETSACICP KGPNAHSAKV SEKVLAKSKQ RARARRKLDF LSTPVELKVC TAAASCARPP  660
LKMDQMSPAA DNISASDVCQ DISQNVPSER VDAIIPPAAN NHRNDLHSPA TLDPFFLEMH  720
EVNASDLLDM SYCDDLIIDS PCYPHDGSFI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-221785352110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008645507.10.0PREDICTED: uncharacterized protein LOC103626929 isoform X2
TrEMBLA0A0A9FY270.0A0A0A9FY27_ARUDO; Uncharacterized protein
TrEMBLC5Y0010.0C5Y001_SORBI; Putative uncharacterized protein Sb04g010300
STRINGSb04g010300.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP142631723
Representative plantOGRP1295045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.17e-37myb domain protein 3r-4